History for ns2.mahindraheavyenginespvtltd.info
Domain: mahindraheavyenginespvtltd.info • Tracking since 2026-08-04 23:25 UTC
DNS response history for ns2.mahindraheavyenginespvtltd.info
ns2.mahindraheavyenginespvtltd.info is a DNS nameserver monitored by NameServerHistory. This page provides historical DNS response-time data, nameserver uptime signals, DNS latency observations, resolved IP history, successful response counts, failed response counts, and reliability indicators for this nameserver.
The selected UTC date is 2026-08-25. For this date, NameServerHistory found 3 DNS check records, 0 successful responses, 3 failed responses, and No measurable response time for the selected date. Current selected-date status: No successful DNS response was recorded for the selected date.
- Use this report to investigate historical DNS uptime and nameserver reliability.
- Compare DNS latency changes, failed DNS checks, and response behavior over time.
- Review the latest resolved IP address and raw DNS check history for ns2.mahindraheavyenginespvtltd.info.
Unreachable on selected date
This nameserver did not return a successful response in the recorded history for the selected date.
Failed checks: 3 / 3
Records on Selected Date
3
Historical checks stored for this nameserver on selected date
Average Latency
N/A
No successful response was recorded for this date
Latest Check on Selected Date
2026-08-25 06:35
All timestamps shown in UTC
Latest Resolved IP on Selected Date
No IP resolved
Most recently resolved hosting IP on selected date
Successful Responses
0
Checks that returned a measurable response
Failed Responses
3
Checks with no response or no returned latency
Failure Rate
100%
Based on the selected date history
Selected Date Status
Unreachable
No successful response was recorded for this date
History for ns2.mahindraheavyenginespvtltd.info
Showing DNS history for 2026-08-25 UTC. Newest records appear first.
Latency bars are scaled to a maximum of 5000 ms for quick visual comparison.
| # | Query Time (UTC) | Correlation ID | Latency | Response | IP Address |
|---|---|---|---|---|---|
| 3 | 2026-08-25 06:35 | 639232346196373643 |
|
- | |
| 2 | 2026-08-25 02:37 | 639232203197189095 |
|
- | |
| 1 | 2026-08-25 00:52 | 639232140250307418 |
|
- |