History for ns4.mahindraheavyenginespvtltd.info
Domain: mahindraheavyenginespvtltd.info • Tracking since 2026-08-04 23:25 UTC
DNS response history for ns4.mahindraheavyenginespvtltd.info
ns4.mahindraheavyenginespvtltd.info is a DNS nameserver monitored by NameServerHistory. This page provides historical DNS response-time data, nameserver uptime signals, DNS latency observations, resolved IP history, successful response counts, failed response counts, and reliability indicators for this nameserver.
The selected UTC date is 2026-09-01. For this date, NameServerHistory found 4 DNS check records, 0 successful responses, 4 failed responses, and No measurable response time for the selected date. Current selected-date status: No successful DNS response was recorded for the selected date.
- Use this report to investigate historical DNS uptime and nameserver reliability.
- Compare DNS latency changes, failed DNS checks, and response behavior over time.
- Review the latest resolved IP address and raw DNS check history for ns4.mahindraheavyenginespvtltd.info.
Unreachable on selected date
This nameserver did not return a successful response in the recorded history for the selected date.
Failed checks: 4 / 4
Records on Selected Date
4
Historical checks stored for this nameserver on selected date
Average Latency
N/A
No successful response was recorded for this date
Latest Check on Selected Date
2026-09-01 14:52
All timestamps shown in UTC
Latest Resolved IP on Selected Date
No IP resolved
Most recently resolved hosting IP on selected date
Successful Responses
0
Checks that returned a measurable response
Failed Responses
4
Checks with no response or no returned latency
Failure Rate
100%
Based on the selected date history
Selected Date Status
Unreachable
No successful response was recorded for this date
History for ns4.mahindraheavyenginespvtltd.info
Showing DNS history for 2026-09-01 UTC. Newest records appear first.
Latency bars are scaled to a maximum of 5000 ms for quick visual comparison.
| # | Query Time (UTC) | Correlation ID | Latency | Response | IP Address |
|---|---|---|---|---|---|
| 4 | 2026-09-01 14:52 | 639238690993873259 |
|
- | |
| 3 | 2026-09-01 10:40 | 639238543127398267 |
|
- | |
| 2 | 2026-09-01 06:36 | 639238392250222581 |
|
- | |
| 1 | 2026-09-01 02:19 | 639238240032549922 |
|
- |